CHD3 Antibody (5E12) - Azide and BSA Free

Immunohistochemistry-Paraffin: CHD3 Antibody (5E12) [H00001107-M01] - Analysis of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 5E12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHD3 Antibody (5E12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CHD3 (NP_001005273, 1654 a.a. ~ 1741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
• Specificity: CHD3 - chromodomain helicase DNA binding protein 3
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CHD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHD3 Antibody (5E12) - Azide and BSA Free

• ATP-dependent helicase CHD3
• CHD-3
• chromodomain helicase DNA binding protein 3
• chromodomain-helicase-DNA-binding protein 3
• EC 3.6.1
• EC 3.6.4.12
• hZFH
• Mi-2 autoantigen 240 kDa protein
• Mi-2a
• Mi2-ALPHA
• ZFH
• Zinc finger helicase
• zinc-finger helicase (Snf2-like)

Background

This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD3
• Entrez:
  • 1107(Human)
• OMIM:
  • 602120(Human)
• Uniprot:
  • NP_001005273(Human)