Centrin 1 Antibody (4C12) - Azide and BSA Free

Western Blot: Centrin 1 Antibody (4C12) [H00001068-M05] - Analysis of CETN1 expression in transfected 293T cell line by CETN1 monoclonal antibody (M05), clone 4C12. Lane 1: CETN1 transfected lysatE (19.6 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Centrin 1 Antibody (4C12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CETN1 (AAH29515.1, 16 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT
• Specificity: CETN1 - centrin, EF-hand protein, 1 (4C12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CETN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 1 Antibody (4C12) - Azide and BSA Free

• calcium binding protein
• Caltractin isoform 2
• caltractin
• CEN1centrin-1
• centrin, EF-hand protein, 1
• CETN
• EF-hand protein

Background

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CETN1
• Entrez:
  • 1068(Human)
• Uniprot:
  • AAH29515(Human)