Centaurin beta 2 Antibody


Immunocytochemistry/ Immunofluorescence: Centaurin beta 2 Antibody [NBP1-84544] - Staining of human cell line U-2 OS shows localization to endosomes.
Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84544] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Centaurin beta 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE
Specificity of human Centaurin beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Centaurin beta 2 Protein (NBP1-84544PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Centaurin beta 2 Antibody

  • Arf GAP with coiled coil, ANK repeat and PH domains 2
  • ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
  • centaurin, beta 2
  • Centaurin-beta-2
  • CENTB2centaurin-beta-2
  • CNT-B2
  • KIAA0041arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Centaurin beta 2 Antibody (NBP1-84544) (0)

There are no publications for Centaurin beta 2 Antibody (NBP1-84544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centaurin beta 2 Antibody (NBP1-84544) (0)

There are no reviews for Centaurin beta 2 Antibody (NBP1-84544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Centaurin beta 2 Antibody (NBP1-84544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Centaurin beta 2 Products

Bioinformatics Tool for Centaurin beta 2 Antibody (NBP1-84544)

Discover related pathways, diseases and genes to Centaurin beta 2 Antibody (NBP1-84544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Centaurin beta 2 Antibody (NBP1-84544)

Discover more about diseases related to Centaurin beta 2 Antibody (NBP1-84544).

Pathways for Centaurin beta 2 Antibody (NBP1-84544)

View related products by pathway.

PTMs for Centaurin beta 2 Antibody (NBP1-84544)

Learn more about PTMs related to Centaurin beta 2 Antibody (NBP1-84544).

Blogs on Centaurin beta 2

There are no specific blogs for Centaurin beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Centaurin beta 2 Antibody and receive a gift card or discount.


Gene Symbol ACAP2