Recombinant Human CELSR2 GST (N-Term) Protein

SDS-Page: Recombinant Human CELSR2 Protein [H00001952-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human CELSR2 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 124-233 of Human CELSR2
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CELSR2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CELSR2 GST (N-Term) Protein

• cadherin EGF LAG seven-pass G-type receptor 2
• Cadherin family member 10
• cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
• CDHF10
• CDHF10FLJ34118
• CELSR2
• EGFL2
• EGFL2FLJ45143
• EGF-like protein 2
• EGF-like-domain, multiple 2
• epidermal growth factor-like 2
• Epidermal growth factor-like protein 2
• Flamingo homolog 3
• Flamingo1
• FLJ45845
• KIAA0279FLJ42737
• MEGF3
• MEGF3cadherin, EGF LAG seven-pass G-type receptor 2, flamingo (Drosophila) homolog
• Multiple EGF-like domains protein 3
• multiple epidermal growth factor-like domains 3
• Multiple epidermal growth factor-like domains protein 3

Background

CELSR2 - cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for CELSR2 Partial Recombinant Protein (H00001952-Q01). (Showing 1 - 1 of 1 FAQ).

1. Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
   • H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.

Bioinformatics

• Gene Symbol: CELSR2