We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CELSR2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CELSR2 Protein [H00001952-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related CELSR2 Peptides and Proteins

Order Details


    • Catalog Number
      H00001952-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CELSR2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 124-233 of Human CELSR2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CELSR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-PAGE
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CELSR2 GST (N-Term) Protein

  • cadherin EGF LAG seven-pass G-type receptor 2
  • Cadherin family member 10
  • cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
  • CDHF10
  • CDHF10FLJ34118
  • CELSR2
  • EGFL2
  • EGFL2FLJ45143
  • EGF-like protein 2
  • EGF-like-domain, multiple 2
  • epidermal growth factor-like 2
  • Epidermal growth factor-like protein 2
  • Flamingo homolog 3
  • Flamingo1
  • FLJ45845
  • KIAA0279FLJ42737
  • MEGF3
  • MEGF3cadherin, EGF LAG seven-pass G-type receptor 2, flamingo (Drosophila) homolog
  • Multiple EGF-like domains protein 3
  • multiple epidermal growth factor-like domains 3
  • Multiple epidermal growth factor-like domains protein 3

Background

CELSR2 - cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38975
Species: Hu
Applications: IHC,  IHC-P
NBP2-43790
Species: Hu
Applications: ICC/IF, WB
NBP2-55658
Species: Hu
Applications: ICC/IF
AF2934
Applications: Block, IHC, Simple Western, WB
NBP2-81771
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-75239
Species: Hu
Applications: ELISA
AF6278
Applications: WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-81938
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-86990
Species: Hu
Applications: ICC/IF, KD, WB

Publications for CELSR2 Partial Recombinant Protein (H00001952-Q01) (0)

There are no publications for CELSR2 Partial Recombinant Protein (H00001952-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CELSR2 Partial Recombinant Protein (H00001952-Q01) (0)

There are no reviews for CELSR2 Partial Recombinant Protein (H00001952-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CELSR2 Partial Recombinant Protein (H00001952-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
    • H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.

Additional CELSR2 Products

Research Areas for CELSR2 Partial Recombinant Protein (H00001952-Q01)

Find related products by research area.

Blogs on CELSR2

There are no specific blogs for CELSR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CELSR2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CELSR2