CELSR2 Antibody Summary
| Immunogen |
Synthetic 19 amino acid peptide from N-terminal extracellular domain of human CELSR2 / EGFL2. |
| Localization |
Integral membrane protein |
| Specificity |
Human CELSR2 / EGFL2. BLAST analysis of the peptide immunogen showed no homology with other human proteins. |
| Predicted Species |
Primate (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CELSR2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin 15 - 20 ug/ml
|
Reactivity Notes
Predicted cross-reactivity based on sequence identity: Gibbon (95%), Marmoset (95%), Monkey (89%), Mouse (84%), Rat (84%), Bovine (84%), Equine (84%).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS |
| Preservative |
0.1% Sodium Azide |
| Concentration |
1.0 mg/ml |
| Purity |
Immunogen affinity purified |
Alternate Names for CELSR2 Antibody
Background
CELSR2 is an Orphan-U GPCR with an unknown ligand. CELSR2 expression has been documented in the developing mouse embryo. ESTs have been isolated from adrenal, B-cell/lung/testis, brain, breast, colon, embryo, heart, heart/melanocyte/uterus, kidney, nerve, skin, testis, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, KD, WB
Publications for CELSR2 Antibody (NLS1942) (0)
There are no publications for CELSR2 Antibody (NLS1942).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CELSR2 Antibody (NLS1942) (0)
There are no reviews for CELSR2 Antibody (NLS1942).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
View specific protocols for CELSR2 Antibody (NLS1942):
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CELSR2 Antibody (NLS1942). (Showing 1 - 1 of 1 FAQ).
-
Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
- H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.
Secondary Antibodies
| |
Isotype Controls
|
Additional CELSR2 Products
Research Areas for CELSR2 Antibody (NLS1942)
Find related products by research area.
|
Blogs on CELSR2