Home » CDR2L » CDR2L Proteins » CDR2L Recombinant Protein Antigen

CDR2L Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CDR2L Protein (NBP1-93681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CDR2L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDR2L.

Source: E.coli

Amino Acid Sequence: DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDR2L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93681.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CDR2L Recombinant Protein Antigen

  • cerebellar degeneration-related protein 2-like
  • HUMPPA
  • paraneoplastic 62 kDa antigen
  • paraneoplastic antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recoverin Antibody
(3F6)
H00005957-M37
Western Blot: Recoverin Antibody (3F6) [H00005957-M37] - Analysis of RCV1 expression in A-431 (Cat # L015V1).
Immunocytochemistry/Immunofluorescence: Recoverin Antibody (3F6) [H00005957-M37] - Analysis of monoclonal antibody to RCVRN on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Recoverin Antibody (3F6) [H00005957-M37] - Detection limit for recombinant GST tagged RCV1 is approximately 1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
GRK1 Antibody (D11)
NB120-2776
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes at room temperature and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Rhodopsin Kinase 1a/b Monclonal Antibody (D11) at a dilution of 1:200 and incubated overnight in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody for 45 minutes at room temperature in the dark. F-actin (red) was stained with a fluorescent phalloidin and nuclei (blue) were stained with DAPI.
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Immunolocalization of GRK1a/b in bovine retina
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Analysis of Rhodopsin Kinase 1a/b (green) in Hela cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes at room temperature and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Rhodopsin Kinase 1a/b Monclonal Antibody (D11) at a dilution of 1:200 and incubated overnight in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody for 45 minutes at room temperature in the dark. F-actin (red) was stained with a fluorescent phalloidin and nuclei (blue) were stained with DAPI. Images were taken at a 60X magnification.
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
CRMP5 Antibody
NBP1-33419
Western Blot: CRMP5 Antibody [NBP1-33419] - Mouse tissue extract (5 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with CRMP5 antibody [N1C1] diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CRMP5 Antibody [NBP1-33419] - DIV10 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min.Green: CRMP5 protein stained by CRMP5 antibody [N1C1] diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-33419] - Paraffin-embedded mouse lung. CRMP5 antibody [N1C1] diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Hippocalcin
Antibody
NBP2-54705
Immunohistochemistry-Paraffin: Hippocalcin Antibody [NBP2-54705] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Species: Hu
Applications: IHC, IHC-P
ELAVL4 Antibody
(6B9)
H00001996-M01
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9 Analysis of ELAVL4 expression in IMR-32.
Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.2 ug/ml.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(1 Publication)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Species: Hu
Applications: WB, IHC, IHC-P, KD
CDR2 Antibody (33)
NBP2-10509
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa control cell lysate and 2) HeLa cell lysate overexpressing CDR2.
Immunohistochemistry: CDR2 Antibody (33) [NBP2-10509] - IHC staining of CDR2 in human breast cancer using DAB with hematoxylin counterstain.
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa, 2) NTERA-2 and 3) HepG2 whole cell lysates.
(1 Publication)
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
NK1R Antibody
NB300-119
Western Blot: NK1R Antibody [NB300-119] - Total protein from human, mouse and rat brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-NK1R in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Immunostain of NK1R in rat enteric glial cells. Image from verified customer review.
Immunohistochemistry: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Staining of human brain, basal nucleus of Meynert, neurons.
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
GM-CSF
7954-GM/CF
GM-CSF
(1 Publication)
Species: Hu
Goat anti-Chicken
IgM Secondary Antibod ...
NB7276
Goat anti-Chicken IgM Secondary Antibody
(36 Publications)
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MLC1 Antibody
NBP1-81555
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining in human cerebral cortex and pancreas tissues using anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: WB, IHC
SLC7A4 Antibody
NBP1-86613
Western Blot: SLC7A4 Antibody [NBP1-86613] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining in human testis and endometrium tissues using anti-SLC7A4 antibody. Corresponding SLC7A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
MUC1 Antibody (SM3)
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CDR2L Protein (NBP1-93681PEP) (0)

There are no publications for CDR2L Protein (NBP1-93681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2L Protein (NBP1-93681PEP) (0)

There are no reviews for CDR2L Protein (NBP1-93681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDR2L Protein (NBP1-93681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional CDR2L Products

Array NBP1-93681PEP

Bioinformatics Tool for CDR2L Protein (NBP1-93681PEP)

Discover related pathways, diseases and genes to CDR2L Protein (NBP1-93681PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CDR2L

There are no specific blogs for CDR2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: NK1R Antibody [NB300-119] - Total protein from human, mouse and rat brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-NK1R in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
NK1R Antibody
NB300-119

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDR2L Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDR2L