CDKL5 Antibody (1D9)

Images

 
Sandwich ELISA: CDKL5 Antibody (1D9) [H00006792-M01] - Detection limit for recombinant GST tagged CDKL5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDKL5 Antibody (1D9) Summary

Immunogen
CDKL5 (AAH36091 722 a.a. - 831 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
Localization
Nuclear
Specificity
CDKL5 - cyclin-dependent kinase-like 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKL5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDKL5 Antibody (1D9)

  • cyclin-dependent kinase-like 5
  • serine/threonine kinase 9
  • serine/threonine-protein kinase 9

Background

This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF1166
Species: Mu
Applications: WB
NBP2-58876
Species: Hu
Applications: ICC/IF
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
MAB27441
Species: Mu
Applications: WB, IHC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006792-M01
Species: Hu
Applications: WB, ELISA

Publications for CDKL5 Antibody (H00006792-M01) (0)

There are no publications for CDKL5 Antibody (H00006792-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL5 Antibody (H00006792-M01) (0)

There are no reviews for CDKL5 Antibody (H00006792-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDKL5 Antibody (H00006792-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL5 Products

Bioinformatics Tool for CDKL5 Antibody (H00006792-M01)

Discover related pathways, diseases and genes to CDKL5 Antibody (H00006792-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL5 Antibody (H00006792-M01)

Discover more about diseases related to CDKL5 Antibody (H00006792-M01).
 

Pathways for CDKL5 Antibody (H00006792-M01)

View related products by pathway.

PTMs for CDKL5 Antibody (H00006792-M01)

Learn more about PTMs related to CDKL5 Antibody (H00006792-M01).
 

Research Areas for CDKL5 Antibody (H00006792-M01)

Find related products by research area.

Blogs on CDKL5

There are no specific blogs for CDKL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL5 Antibody (1D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL5
Entrez