CDC37 Recombinant Protein Antigen

Images

 
There are currently no images for CDC37 Protein (NBP1-80960PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC37 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC37.

Source: E. coli

Amino Acid Sequence: DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC37
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80960.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC37 Recombinant Protein Antigen

  • CDC37 (cell division cycle 37, S. cerevisiae, homolog)
  • CDC37 cell division cycle 37 homolog (S. cerevisiae)
  • CDC37 cell division cycle 37 homolog
  • CDC37A
  • cell division cycle 37 homolog (S. cerevisiae)
  • Hsp90 chaperone protein kinase-targeting subunit
  • hsp90 co-chaperone Cdc37
  • P50CDC37

Background

In S. cerevisiae, Cdc37 has been shown to be an important regulator of cell division cycle through its action on cyclin-dependent kinases (CDK's). Cdc37 has also been associated with signaling pathways and kinases unrelated to cell cycle control, including v-Src, casein kinase II, MPS1 kinase and the sevenless receptor tyrosine kinase. Interestingly, HSP90 has also been shown to be associated with many of the same cellular targets as Cdc37. It has now been shown that Cdc37 is the same protein previously described as p50 which has been found to be associated with many of the same proteins as HSP90. Among others, Cdc37/p50 has been found complexed with Src-family kinases (Fyn, Yes, Fes, Lck & Fgr), Raf and pp60v-src. More recently, Cdc37 has been shown to be a chaperone independently and in concert with HSP90. In fact, Cdc37 is necessary for the binding of HSP90 to Cdk4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB

Publications for CDC37 Protein (NBP1-80960PEP) (0)

There are no publications for CDC37 Protein (NBP1-80960PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC37 Protein (NBP1-80960PEP) (0)

There are no reviews for CDC37 Protein (NBP1-80960PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC37 Protein (NBP1-80960PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC37 Products

Research Areas for CDC37 Protein (NBP1-80960PEP)

Find related products by research area.

Blogs on CDC37

There are no specific blogs for CDC37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC37 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC37