Recombinant Human CDC2L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDC2L1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human CDC2L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK11B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC2L1 Protein

  • CDC2L1p58 CLK-1
  • CDC-related protein kinase p58
  • CDK11-p110
  • CDK11-p46
  • CDK11-p58
  • CDK11PITSLRE serine/threonine-protein kinase CDC2L1
  • cell division cycle 2-like 1 (PITSLRE proteins)
  • Cell division cycle 2-like protein kinase 1
  • Cell division protein kinase 11B
  • cell division protein kinase 11B-like
  • CLK-1
  • cyclin-dependent kinase 11B
  • EC 2.7.11
  • EC 2.7.11.22
  • FLJ59152
  • Galactosyltransferase-associated protein kinase p58/GTA
  • p58
  • p58CDC2L1
  • p58CLK-1
  • PITSLREA
  • PK58

Background

CDC2L1 - cell division cycle 2-like 1 (PITSLRE proteins)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-90034
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00000984-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CDC2L1 Partial Recombinant Protein (H00000984-Q01) (0)

There are no publications for CDC2L1 Partial Recombinant Protein (H00000984-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2L1 Partial Recombinant Protein (H00000984-Q01) (0)

There are no reviews for CDC2L1 Partial Recombinant Protein (H00000984-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC2L1 Partial Recombinant Protein (H00000984-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC2L1 Products

Bioinformatics Tool for CDC2L1 Partial Recombinant Protein (H00000984-Q01)

Discover related pathways, diseases and genes to CDC2L1 Partial Recombinant Protein (H00000984-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CDC2L1 Partial Recombinant Protein (H00000984-Q01)

Find related products by research area.

Blogs on CDC2L1

There are no specific blogs for CDC2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CDC2L1 Antibody
NB100-495

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDC2L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK11B