CD97 Recombinant Protein Antigen

Images

 
There are currently no images for CD97 Protein (NBP1-86935PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD97 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD97.

Source: E. coli

Amino Acid Sequence: RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADGRE5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86935.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD97 Recombinant Protein Antigen

  • CD97 antigenseven-span transmembrane protein
  • CD97 molecule
  • Leukocyte antigen CD97
  • seven transmembrane helix receptor
  • seven-transmembrane, heterodimeric receptor associated with inflammation
  • TM7LN1

Background

CD97, a CD55 Receptor, is a leukocyte antigen located on most activated leukocytes. CD97 is highly homologous to EMR2 with five EGF-like domains in the N-terminal extracellular domain, suggesting that it may be involved in cell signaling as well as in cell adhesion (Hamann et al., 1996). Two variants are produced by alternative splicing, where the shorter form lacks exons 5 and 6 and reduces the number of EGF-like domains from 5 to 3, compared to the full-length isoform. CD97 is associated with with the activated lesions of multiple sclerosis. CD97 expression is also implicated in the dedifferentiation of colon and thyroid tumors. CD97 is expressed abundantly in cells of hematopoietic origin and is markedly upregulated on activated T and B cells. ESTs have been isolated from a wide variety of tissue libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2009
Species: Hu
Applications: ICC, IHC
236-EG
Species: Hu
Applications: BA
AF4894
Species: Hu
Applications: Neut, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB5580
Species: Mu
Applications: CyTOF-ready, Flow, ICC
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
NBP2-46010
Species: Ca, Hu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB8496
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB600-404
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, RIA, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
NBP1-86935PEP
Species: Hu
Applications: AC

Publications for CD97 Protein (NBP1-86935PEP) (0)

There are no publications for CD97 Protein (NBP1-86935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD97 Protein (NBP1-86935PEP) (0)

There are no reviews for CD97 Protein (NBP1-86935PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD97 Protein (NBP1-86935PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD97 Products

Research Areas for CD97 Protein (NBP1-86935PEP)

Find related products by research area.

Blogs on CD97

There are no specific blogs for CD97, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD97 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRE5