CD79B Recombinant Protein Antigen

Images

 
There are currently no images for CD79B Recombinant Protein Antigen (NBP3-21270PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD79B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD79B

Source: E.coli

Amino Acid Sequence: RNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD79B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21270. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD79B Recombinant Protein Antigen

  • B29
  • B29B-cell-specific glycoprotein B29
  • B-cell antigen receptor complex-associated protein beta chain
  • CD79B antigen (immunoglobulin-associated beta)
  • CD79b antigen
  • CD79b molecule, immunoglobulin-associated beta
  • CD79B
  • IGB
  • IGBAGM6
  • Ig-beta
  • Immunoglobulin-associated B29 protein

Background

Murine CD79 is a 23/21 kDa disulfide-linked heterodimer composed of an alpha chain (CD79alpha/mb-1) and a beta chain (CD79b/B29) that associates non-covalently with membrane immunoglobulin (Ig) to form the B cell receptor (BCR) complex. Its expression is restricted to B lymphocytes, first appearing on the surface at the pro-B cell stage prior to productive Ig gene rearrangements and remaining through all stages of B-cell differentiation prior to plasma cells. It has been proposed that the CD79 complex on pro-B cell surfaces may function to induce early B-cell differentiation. (1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44738
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
1968-SL
Species: Hu
Applications: BA
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
NBP2-37585
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB123
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
1544-IR
Species: Hu
Applications: Bind
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-25265
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for CD79B Recombinant Protein Antigen (NBP3-21270PEP) (0)

There are no publications for CD79B Recombinant Protein Antigen (NBP3-21270PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD79B Recombinant Protein Antigen (NBP3-21270PEP) (0)

There are no reviews for CD79B Recombinant Protein Antigen (NBP3-21270PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD79B Recombinant Protein Antigen (NBP3-21270PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD79B Products

Research Areas for CD79B Recombinant Protein Antigen (NBP3-21270PEP)

Find related products by research area.

Blogs on CD79B.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD79B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD79B