CD39L3/ENTPD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CD39L3/ENTPD3 Antibody [NBP2-57781] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD39L3/ENTPD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGAT
Specificity
Specificity of human CD39L3/ENTPD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENTPD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD39L3/ENTPD3 Recombinant Protein Antigen (NBP2-57781PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CD39L3/ENTPD3 Antibody

  • ATPDase
  • CD39 antigen-like 3
  • CD39L3
  • CD39L3EC 3.6.1.5
  • CD39-like 3
  • EC 3.6.1
  • Ecto-apyrase 3
  • Ecto-ATP diphosphohydrolase 3
  • Ecto-ATPase 3
  • Ecto-ATPDase 3
  • ectonucleoside triphosphate diphosphohydrolase 3
  • ENTPD3
  • FLJ93839
  • HB6
  • HB6NTPDase 3
  • NTPDase-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-32294
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85751
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-42813
Species: Dr, Hu(-)
Applications: WB, ICC/IF
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
5255-EN
Species: Hu
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for CD39L3/ENTPD3 Antibody (NBP2-57781) (0)

There are no publications for CD39L3/ENTPD3 Antibody (NBP2-57781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD39L3/ENTPD3 Antibody (NBP2-57781) (0)

There are no reviews for CD39L3/ENTPD3 Antibody (NBP2-57781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD39L3/ENTPD3 Antibody (NBP2-57781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD39L3/ENTPD3 Antibody (NBP2-57781)

Discover related pathways, diseases and genes to CD39L3/ENTPD3 Antibody (NBP2-57781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L3/ENTPD3 Antibody (NBP2-57781)

Discover more about diseases related to CD39L3/ENTPD3 Antibody (NBP2-57781).
 

Pathways for CD39L3/ENTPD3 Antibody (NBP2-57781)

View related products by pathway.

Research Areas for CD39L3/ENTPD3 Antibody (NBP2-57781)

Find related products by research area.

Blogs on CD39L3/ENTPD3

There are no specific blogs for CD39L3/ENTPD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD39L3/ENTPD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD3