Recombinant Human CD39L1/ENTPD2 Protein

Product Discontinued

Recombinant Human CD39L1/ENTPD2 Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-89 of Human ENTPD2 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:GRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVL

• Protein/Peptide Type: Partial Recombinant Protein
• Gene: ENTPD2

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD39L1/ENTPD2 Protein

• CD39 antigen-like 1
• CD39L1
• CD39L1NTPDase 2
• CD39-like-1
• EC 3.6.1
• EC 3.6.1.-
• EC 3.6.1.5
• Ecto-ATP diphosphohydrolase 2
• Ecto-ATPase 2
• Ecto-ATPase
• Ecto-ATPDase 2
• ectonucleoside triphosphate diphosphohydrolase 2
• ENTPD2
• NTPD2
• NTPDase 2
• NTPDase-2

Background

The protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ENTPD2