Recombinant Human CD300c Protein

Product Discontinued

Recombinant Human CD300c Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-224 of Human CD300C full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: CD300C

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD300c Protein

• CD300c antigenCMRF35 antigen
• CD300c molecule
• CD300c
• CLM6
• CLM-6
• CMRF35 leukocyte immunoglobulin-like receptor
• CMRF35
• CMRF-35
• CMRF35A leukocyte immunoglobulin-like receptor
• CMRF-35A
• CMRF35ACMRF35A1
• CMRF35CMRF35-A1
• CMRF35-like molecule 6
• IGSF16
• IgSF16
• IGSF16CD300 antigen-like family member C
• Immunoglobulin superfamily member 16
• LIR

Background

CD300C( AAH22279, 21 a.a. - 225 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for CD300c Recombinant Protein (H00010871-P01). (Showing 1 - 1 of 1 FAQ).

1. Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
   • A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Bioinformatics

• Gene Symbol: CD300C