CD300c Recombinant Protein Antigen

Images

 
There are currently no images for CD300c Recombinant Protein Antigen (NBP1-84432PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD300c Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300C.

Source: E. coli

Amino Acid Sequence: PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD300C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84432.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD300c Recombinant Protein Antigen

  • CD300c antigenCMRF35 antigen
  • CD300c molecule
  • CD300c
  • CLM6
  • CLM-6
  • CMRF35 leukocyte immunoglobulin-like receptor
  • CMRF35
  • CMRF-35
  • CMRF35A leukocyte immunoglobulin-like receptor
  • CMRF-35A
  • CMRF35ACMRF35A1
  • CMRF35CMRF35-A1
  • CMRF35-like molecule 6
  • IGSF16
  • IgSF16
  • IGSF16CD300 antigen-like family member C
  • Immunoglobulin superfamily member 16
  • LIR

Background

CD300C - CD300C antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB20172
Species: Hu
Applications: CyTOF-reported, Neut, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2640
Species: Hu
Applications: ELISA, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
MAB2078
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
AF2788
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6364
Species: Hu
Applications: CyTOF-ready, Flow
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00004077-M01
Species: Hu, Mu
Applications: EM, ELISA, ICC/IF, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB

Publications for CD300c Recombinant Protein Antigen (NBP1-84432PEP) (0)

There are no publications for CD300c Recombinant Protein Antigen (NBP1-84432PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300c Recombinant Protein Antigen (NBP1-84432PEP) (0)

There are no reviews for CD300c Recombinant Protein Antigen (NBP1-84432PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD300c Recombinant Protein Antigen (NBP1-84432PEP). (Showing 1 - 1 of 1 FAQ).

  1. Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
    • A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Additional CD300c Products

Research Areas for CD300c Recombinant Protein Antigen (NBP1-84432PEP)

Find related products by research area.

Blogs on CD300c

There are no specific blogs for CD300c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD300c Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD300C