![Immunohistochemistry-Paraffin: CC2D2A Antibody [NBP1-93673] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/CC2D2A-Antibody-Immunohistochemistry-Paraffin-NBP1-93673-img0002.jpg "Immunohistochemistry-Paraffin: CC2D2A Antibody [NBP1-93673] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSN |
| Specificity | Specificity of human CC2D2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CC2D2A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-93673 | Applications | Species |
|---|---|---|
| Wang WJ, Tay HG, Soni R et al. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nat Cell Biol 2013 Jun [PMID: 23644468] |
Secondary Antibodies |
Isotype Controls |
Diseases for CC2D2A Antibody (NBP1-93673)Discover more about diseases related to CC2D2A Antibody (NBP1-93673).
| Pathways for CC2D2A Antibody (NBP1-93673)View related products by pathway.
|
PTMs for CC2D2A Antibody (NBP1-93673)Learn more about PTMs related to CC2D2A Antibody (NBP1-93673).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CC2D2A |
![Western Blot: Meckelin Antibody [NBP1-06590] - Immunodetection of Meckelin (120kDa) in whole cell extracts of HEK293 cells.](http://images.novusbio.com/fullsize2/Meckelin Antibody-Western Blot-NBP1-06590-img0003.jpg)
![Immunohistochemistry-Paraffin: Meckelin Antibody [NBP1-06590] - Staining of kidney tissue section with Meckelin Antibody (NBP1-06590).](http://images.novusbio.com/fullsize2/Meckelin Antibody-Immunohistochemistry-Paraffin-NBP1-06590-img0002.jpg)
![Immunohistochemistry-Paraffin: RPGRIP1L Antibody [NBP1-84403] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize2/RPGRIP1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84403-img0001.jpg)
![Western Blot: CEP290 Antibody [NB100-86991] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 mcg) cells. NB100-86991 used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.](http://images.novusbio.com/fullsize2/CEP290-Antibody-Western-Blot-NB100-86991-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: CEP290 Antibody [NB100-86991] - NBF-fixed asynchronous HeLa cells. Antibody used at a dilution of 1:500.](http://images.novusbio.com/fullsize2/CEP290-Antibody-Immunocytochemistry-Immunofluorescence-NB100-86991-img0007.jpg)
![Western Blot: CEP290 Antibody [NB100-86991] - Species: Mouse, Cell line: Brain homogenate, Primary antibody dilution: 1:400. Band detected at 300KDa. This image has been provided by Manfred W. Kilimann, MD, PhD, Professor in Molecular Cell Biology, Uppsala University.](http://images.novusbio.com/fullsize2/CEP290-Antibody-Western-Blot-NB100-86991-img0008.jpg)
![Western Blot: MKS1 Antibody [NBP1-88691] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize2/MKS1 Antibody-Western Blot-NBP1-88691-img0005.jpg)
![Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88691] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/MKS1-Antibody-Immunohistochemistry-Paraffin-NBP1-88691-img0002.jpg)
![Western Blot: AHI1 Antibody [NBP2-15309] - Sample (30 ug of whole cell lysate) A: IMR32 7.5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/AHI1 Antibody-Western Blot-NBP2-15309-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: AHI1 Antibody [NBP2-15309] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/AHI1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-15309-img0001.jpg)
![Immunohistochemistry-Paraffin: AHI1 Antibody [NBP2-15309] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/AHI1 Antibody-Immunohistochemistry-Paraffin-NBP2-15309-img0002.jpg)
![Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in mouse testis.](http://images.novusbio.com/fullsize2/Nephronophthisis-Antibody-Western-Blot-H00004867-D01P-img0002.jpg)
![Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in A-431.](http://images.novusbio.com/fullsize2/Nephronophthisis-Antibody-Western-Blot-H00004867-D01P-img0001.jpg)
![Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in transfected 293T cell line by NPHP1 polyclonal antibody.Lane 1: NPHP1 transfected lysate(14.30 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/Nephronophthisis Antibody-Western Blot-H00004867-D01P-img0003.jpg)
![Immunohistochemistry-Paraffin: B9D1 Antibody [NBP1-88969] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.](http://images.novusbio.com/fullsize/B9D1 Antibody-Immunohistochemistry-Paraffin-NBP1-88969-img0002.jpg)
![Western Blot: ARL13B Antibody [NBP2-15463] - Sample (50 ug of whole cell lysate) A: Mouse Liver, 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/ARL13B Antibody-Western Blot-NBP2-15463-img0002.jpg)
![Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-15463] - Immunohistochemical analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/ARL13B Antibody-Immunohistochemistry-Paraffin-NBP2-15463-img0003.jpg)
![Western Blot: ARL13B Antibody [NBP2-15463] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/ARL13B Antibody-Western Blot-NBP2-15463-img0001.jpg)
![Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/MKKS-Antibody-Western-Blot-NBP1-92123-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.](http://images.novusbio.com/fullsize2/MKKS Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92123-img0008.jpg)
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0007.jpg)
![Western Blot: Transmembrane protein 216 Overexpression Lysate (Adult Normal) [NBL1-17065] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Transmembrane protein 216.](http://images.novusbio.com/fullsize/Transmembrane protein 216 Overexpression Lysate (Adult Normal)-Western Blot-NBL1-17065-img0002.jpg)
![Immunohistochemistry: NPHP4 Antibody [NBP2-39059] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/NPHP4 Antibody-Immunohistochemistry-NBP2-39059-img0001.jpg)
![Western Blot: Septin-6 Antibody [NBP1-89626] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize2/Septin-6 Antibody-Western Blot-NBP1-89626-img0007.jpg)
![Immunohistochemistry-Paraffin: Septin-6 Antibody [NBP1-89626] - Staining of human lymph node shows cytoplasmic positivity in reaction center cells.](http://images.novusbio.com/fullsize2/Septin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-89626-img0006.jpg)
![Western Blot: Septin-6 Antibody [NBP1-89626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Septin-6-Antibody-Western-Blot-NBP1-89626-img0004.jpg)
![Western Blot: Septin-2 Antibody [NBP1-85212] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize2/Septin-2-Antibody-Western-Blot-NBP1-85212-img0014.jpg)
![Immunocytochemistry: Septin-2 Antibody [NBP1-85212] - Imaging of cultured rat corrtical astrocytes. This image was submitted via customer Review.](http://images.novusbio.com/fullsize2/Septin-2-Antibody-Immunocytochemistry-NBP1-85212-img0012.jpg)
![Immunohistochemistry-Paraffin: Septin-2 Antibody [NBP1-85212] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Septin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85212-img0010.jpg)
![Western Blot: TMEM231 Antibody [NBP1-91905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/TMEM231-Antibody-Western-Blot-NBP1-91905-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: TMEM231 Antibody [NBP1-91905] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/fullsize2/TMEM231-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91905-img0007.jpg)
![Immunohistochemistry-Paraffin: TMEM231 Antibody [NBP1-91905] - Staining in human fallopian tube and prostate tissues using anti-TMEM231 antibody. Corresponding TMEM231 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/TMEM231-Antibody-Immunohistochemistry-Paraffin-NBP1-91905-img0010.jpg)
![Immunohistochemistry-Paraffin: NPHP3 Antibody [NBP1-83543] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize2/NPHP3-Antibody-Immunohistochemistry-Paraffin-NBP1-83543-img0004.jpg)
![Western Blot: CC2D1A Antibody [NB500-255] - Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells](http://images.novusbio.com/fullsize2/CC2D1A-Antibody-Western-Blot-NB500-255-img0008.jpg)
![Immunohistochemistry-Paraffin: CC2D1A Antibody [NB500-255] - Human colon carcinoma. Antibody used at a dilution of 1:1000 (1ug/ml).](http://images.novusbio.com/fullsize2/CC2D1A Antibody-Immunohistochemistry-Paraffin-NB500-255-img0002.jpg)
![Western Blot: CC2D1A Antibody [NB500-255] - Detection of Human TOUF/FLJ20241 on HeLa whole cell lysate using NB500-255.](http://images.novusbio.com/fullsize2/CC2D1A Antibody-Western Blot-NB500-255-img0001.jpg)
![Western Blot: CCDC135 Overexpression Lysate (Adult Normal) [NBL1-08780] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for CCDC135.](http://images.novusbio.com/fullsize/CCDC135 Overexpression Lysate (Adult Normal)-Western Blot-NBL1-08780-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")