CC2D2A Antibody

Images

 
Immunohistochemistry-Paraffin: CC2D2A Antibody [NBP1-93673] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CC2D2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSN
Specificity
Specificity of human CC2D2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CC2D2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CC2D2A Protein (NBP1-93673PEP)
Publications
Read Publication using NBP1-93673.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Reactivity reported in scientific literature (PMID: 23644468)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CC2D2A Antibody

  • coiled-coil and C2 domain containing 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP, ICC, IF
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP1-88969
Species: Hu
Applications: IHC, IHC-P
NBP2-15463
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17065
Species: Hu
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
NBP1-89626
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00027130-P02
Species: Hu
NBP1-91905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NB500-255
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-08780
Species: Hu
NBP1-93673
Species: Hu
Applications: IHC, IHC-P

Publications for CC2D2A Antibody (NBP1-93673)(1)

Reviews for CC2D2A Antibody (NBP1-93673) (0)

There are no reviews for CC2D2A Antibody (NBP1-93673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CC2D2A Antibody (NBP1-93673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-93673

Bioinformatics Tool for CC2D2A Antibody (NBP1-93673)

Discover related pathways, diseases and genes to CC2D2A Antibody (NBP1-93673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CC2D2A Antibody (NBP1-93673)

Discover more about diseases related to CC2D2A Antibody (NBP1-93673).
 

Pathways for CC2D2A Antibody (NBP1-93673)

View related products by pathway.

PTMs for CC2D2A Antibody (NBP1-93673)

Learn more about PTMs related to CC2D2A Antibody (NBP1-93673).

Blogs on CC2D2A

There are no specific blogs for CC2D2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CC2D2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CC2D2A