Home » CC2D2A » CC2D2A Antibodies » CC2D2A Antibody

CC2D2A Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CC2D2A Antibody [NBP1-93673] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: CC2D2A Antibody [NBP1-93673] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CC2D2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CC2D2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CC2D2A Protein (NBP1-93673PEP)
Publications
Read Publication using NBP1-93673.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Reactivity reported in scientific literature (PMID: 23644468)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CC2D2A Antibody

  • coiled-coil and C2 domain containing 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Meckelin Antibody
NBP1-06590
Immunohistochemistry-Paraffin: Meckelin Antibody [NBP1-06590] - Staining of kidney tissue section with Meckelin Antibody (NBP1-06590).
Western Blot: Meckelin Antibody [NBP1-06590] - Immunodetection of Meckelin (120kDa) in whole cell extracts of HEK293 cells.
(2 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RPGRIP1L Antibody
NBP1-84403
Immunohistochemistry-Paraffin: RPGRIP1L Antibody [NBP1-84403] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CEP290 Antibody
NB100-86991
Western Blot: CEP290 Antibody [NB100-86991] - Detection of human CEP290 by western blot and immunoprecipitation. Samples: Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-CEP290 antibody NB100-86991 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 10 second (B).
Western Blot: CEP290 Antibody [NB100-86991] - Representative examples of immunoblot images of purified olfactory cilia. Three distinct cilia preparations each from LRBA-KO and WT mice (age, 4 weeks) were blotted in parallel (10 ug protein each), along with an OE and a brain sample (50 ug protein each), all shown at the same exposure. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-08543-4) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: CEP290 Antibody [NB100-86991] - NBF-fixed asynchronous HeLa cells. Antibody used at a dilution of 1:500.
(10 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
MKS1 Antibody
NBP1-88692
Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88692] - Staining of human fallopian tube.
Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88692] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88692] - Staining of human kidney.
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AHI1 Antibody
NBP2-15309
Immunocytochemistry/Immunofluorescence: AHI1 Antibody [NBP2-15309] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AHI1 Antibody [NBP2-15309] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Western Blot: AHI1 Antibody [NBP2-15309] - Sample (30 ug of whole cell lysate) A: IMR32 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Nephronophthisis
Antibody
NBP2-94059
Western Blot: Nephronophthisis Antibody [NBP2-94059] - Analysis of extracts of Mouse pancreas, using NPHP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Western Blot: Nephronophthisis Antibody [NBP2-94059] - Analysis of extracts of Mouse pancreas, using NPHP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Nephronophthisis Antibody [NBP2-94059] - Rat kidney using NPHP1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
B9D1 Antibody
NBP2-92821
Immunohistochemistry-Paraffin: B9D1 Antibody [NBP2-92821] - Paraffin-embedded human stomach using B9D1 .
Immunohistochemistry-Paraffin: B9D1 Antibody [NBP2-92821] - Paraffin-embedded mouse lung using B9D1 .
Western Blot: B9D1 Antibody [NBP2-92821] - Analysis of extracts of various cell lines, using B9D1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ARL13B Antibody
NBP2-15463
Western Blot: ARL13B Antibody [NBP2-15463] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE gel, diluted at 1:1000.
Western Blot: ARL13B Antibody [NBP2-15463] - Sample (50 ug of whole cell lysate) A: Mouse Liver, 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-15463] - U87 xenograft, using ARL13B antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(48 Publications)
Species: Hu
Applications: BA
MKKS Antibody
NBP1-92123
Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon, kidney, testis and urinary bladder using Anti-MKKS antibody NBP1-92123 (A) shows similar protein distribution across tissues to independent antibody NBP1-92122 (B).
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human kidney.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TMEM216
Overexpression Lysate
NBL1-17065
Western Blot: Transmembrane protein 216 Overexpression Lysate (Adult Normal) [NBL1-17065] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Transmembrane protein 216.
Species: Hu
Applications: WB
NPHP4 Antibody
NBP3-17404
Immunocytochemistry/Immunofluorescence: NPHP4 Antibody [NBP3-17404] - Staining of human cell line HEK 293 shows localization to nucleoplasm, nuclear bodies & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Septin-6 Antibody
NBP1-89626
Western Blot: Septin-6 Antibody [NBP1-89626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Septin-6 Antibody [NBP1-89626] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: Septin-6 Antibody [NBP1-89626] - Staining of human lymph node shows cytoplasmic positivity in reaction center cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Septin-2 Antibody
NBP1-85212
Immunohistochemistry-Paraffin: Septin-2 Antibody [NBP1-85212] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Immunocytochemistry/Immunofluorescence: Septin-2 Antibody [NBP1-85212] - Imaging of cultured rat corrtical astrocytes. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Septin-2 Antibody [NBP1-85212] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Recombinant Human
Inversin GST (N-Term) ...
H00027130-P02
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
TMEM231 Antibody
NBP1-91905
Immunocytochemistry/Immunofluorescence: TMEM231 Antibody [NBP1-91905] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TMEM231 Antibody [NBP1-91905] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: TMEM231 Antibody [NBP1-91905] - Staining of human prostate shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NPHP3 Antibody
NBP1-83543
Immunohistochemistry-Paraffin: NPHP3 Antibody [NBP1-83543] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CC2D1A Antibody
NB500-255
Western Blot: CC2D1A Antibody [NB500-255] - Detection of Human TOUF/FLJ20241 on HeLa whole cell lysate using NB500-255.
Immunohistochemistry-Paraffin: CC2D1A Antibody [NB500-255] - Human colon carcinoma. Antibody used at a dilution of 1:1000 (1ug/ml).
Western Blot: CC2D1A Antibody [NB500-255] - Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
CCDC135
Overexpression Lysate
NBL1-08780
Western Blot: CCDC135 Overexpression Lysate (Adult Normal) [NBL1-08780] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for CCDC135.
Species: Hu
Applications: WB
CC2D2A Antibody
NBP1-93673
CC2D2A Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for CC2D2A Antibody (NBP1-93673)(1)


Reviews for CC2D2A Antibody (NBP1-93673) (0)

There are no reviews for CC2D2A Antibody (NBP1-93673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CC2D2A Antibody (NBP1-93673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CC2D2A Products

Bioinformatics Tool for CC2D2A Antibody (NBP1-93673)

Discover related pathways, diseases and genes to CC2D2A Antibody (NBP1-93673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CC2D2A Antibody (NBP1-93673)

Discover more about diseases related to CC2D2A Antibody (NBP1-93673).
 

Pathways for CC2D2A Antibody (NBP1-93673)

View related products by pathway.

PTMs for CC2D2A Antibody (NBP1-93673)

Learn more about PTMs related to CC2D2A Antibody (NBP1-93673).

Blogs on CC2D2A

There are no specific blogs for CC2D2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CC2D2A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CC2D2A