CBFB Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CBFB Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBFB.
  
  

  Source: E. coli

  Amino Acid Sequence: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CBFB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87300.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CBFB Recombinant Protein Antigen

• CBFB
• CBF-beta
• core-binding factor subunit beta
• core-binding factor, beta subunit
• PEA2-beta
• PEBP2B
• PEBP2-beta
• polyomavirus enhancer binding protein 2, beta subunit
• Polyomavirus enhancer-binding protein 2 beta subunit
• SL3/AKV core-binding factor beta subunit
• SL3-3 enhancer factor 1 beta subunit
• SL3-3 enhancer factor 1 subunit beta
• SL3-3

Background

The transcription factor Polyomavirus enhancer binding protein 2 (PEBP2), also designated Osf2 (Osteoblast-specific transcription factor), CBFA1 (Core Binding Factor) and AML3 (Acute myeloid leukemia), is composed of two subunits, alpha and beta, which are essential for the regulation of hematopoiesis and osteogenesis. The PEBP2alpha subunits, PEBP2alphaA, PEBP2alphaB and PEBP2alphaC, are encoded by three RUNX genes, all of which contain a 128-amino acid region homologous to the highly conserved Drosophila segmentation gene, runt. This region is involved in DNA binding and heterodimerization with the regulatory beta subunit, which facilitates DNA binding of the alpha subunit. Both subunits are required for in vivo function; the disruption of either gene results in a lack of definitive hematopoiesis followed by embryo death in utero due to hemorrhage in the central nervous system. The gene encoding PEBP2beta is the target of chromosomal inversion 16 (p13;q22) with the smooth muscle myosin heavy chain, producing a chimeric gene, PEBP2beta/CBFbeta-SMMHC, that is associated with human acute myeloid leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CBFB