CBFB Recombinant Protein Antigen

Images

 
There are currently no images for CBFB Protein (NBP1-87300PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CBFB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBFB.

Source: E. coli

Amino Acid Sequence: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CBFB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87300.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CBFB Recombinant Protein Antigen

  • CBFB
  • CBF-beta
  • core-binding factor subunit beta
  • core-binding factor, beta subunit
  • PEA2-beta
  • PEBP2B
  • PEBP2-beta
  • polyomavirus enhancer binding protein 2, beta subunit
  • Polyomavirus enhancer-binding protein 2 beta subunit
  • SL3/AKV core-binding factor beta subunit
  • SL3-3 enhancer factor 1 beta subunit
  • SL3-3 enhancer factor 1 subunit beta
  • SL3-3

Background

The transcription factor Polyomavirus enhancer binding protein 2 (PEBP2), also designated Osf2 (Osteoblast-specific transcription factor), CBFA1 (Core Binding Factor) and AML3 (Acute myeloid leukemia), is composed of two subunits, alpha and beta, which are essential for the regulation of hematopoiesis and osteogenesis. The PEBP2alpha subunits, PEBP2alphaA, PEBP2alphaB and PEBP2alphaC, are encoded by three RUNX genes, all of which contain a 128-amino acid region homologous to the highly conserved Drosophila segmentation gene, runt. This region is involved in DNA binding and heterodimerization with the regulatory beta subunit, which facilitates DNA binding of the alpha subunit. Both subunits are required for in vivo function; the disruption of either gene results in a lack of definitive hematopoiesis followed by embryo death in utero due to hemorrhage in the central nervous system. The gene encoding PEBP2beta is the target of chromosomal inversion 16 (p13;q22) with the smooth muscle myosin heavy chain, producing a chimeric gene, PEBP2beta/CBFbeta-SMMHC, that is associated with human acute myeloid leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46466
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-66967
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47525
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-55747
Species: Hu
Applications: ICC/IF
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF5129
Species: Hu
Applications: WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB

Publications for CBFB Protein (NBP1-87300PEP) (0)

There are no publications for CBFB Protein (NBP1-87300PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBFB Protein (NBP1-87300PEP) (0)

There are no reviews for CBFB Protein (NBP1-87300PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CBFB Protein (NBP1-87300PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBFB Products

Research Areas for CBFB Protein (NBP1-87300PEP)

Find related products by research area.

Blogs on CBFB

There are no specific blogs for CBFB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CBFB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CBFB