Carboxypeptidase A2/CPA2 Antibody (2E11)

Western Blot: Carboxypeptidase A2/CPA2 Antibody (2E11) [H00001358-M02] - Analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody (M02), clone 2E11.Lane 1: CPA2 transfected lysate(46.8 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: Carboxypeptidase A2/CPA2 Antibody (2E11) [H00001358-M02] - Analysis of CPA2 transfected lysate using anti-CPA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CPA2 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: Carboxypeptidase A2/CPA2 Antibody (2E11) [H00001358-M02] - Detection limit for recombinant GST tagged CPA2 is 0.3 ng/ml as a capture antibody.

Product Discontinued

Carboxypeptidase A2/CPA2 Antibody (2E11) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT*
• Specificity: CPA2 (2E11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CPA2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carboxypeptidase A2/CPA2 Antibody (2E11)

• carboxypeptidase A2 (pancreatic)
• Carboxypeptidase A2
• CPA2
• EC 3.4.17
• EC 3.4.17.15

Background

Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPA2
• Entrez:
  • 1358(Human)
• OMIM:
  • 600688(Human)
• Uniprot:
  • NP_001860(Human)