We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Carbonic Anhydrase VB/CA5B Recombinant Protein Antigen

Images

 
There are currently no images for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carbonic Anhydrase VB/CA5B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CA5B.

Source: E. coli

Amino Acid Sequence: GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86090.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase VB/CA5B Recombinant Protein Antigen

  • CA5B
  • Carbonate dehydratase VB
  • carbonic anhydrase 5B, mitochondrial
  • Carbonic Anhydrase VB
  • carbonic anhydrase VB, mitochondrial
  • carbonic dehydratase
  • CAVB
  • CA-VB
  • EC 4.2.1.1
  • MGC39962

Background

Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes responsible for catalyzing the reversible hydration of carbon dioxide.CAs show extensive diversity in their distribution and subcellular localization.They are involved in a variety of biological processes, including calcification, bone resorption, respiration, acid-base balance and the formation of aqueous humor, saliva, gastric juice and cerebrospinal fluid. CA VB, also known as carbonate dehydratase VB, is one of two isoforms of CA V. It localizes to the mitochondria and is involved in metabolic processes. CA VB is predominantly expressed in heart, pancreas, lung, placenta, kidney and skeletal muscle. It exhibits highest homology with family member CA VA (the second isoform of CA V); however, unlike CA VA, it is not expressed in the liver, suggesting that it plays a significantly different physiological role.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DGD150
Species: Hu
Applications: ELISA
NB600-507
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, PEP-ELISA, WB
MAB7185
Species: Hu
Applications: Simple Western, WB
NBP2-03374
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-32731
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP3-17937
Species: Hu
Applications: ICC/IF, WB
H00011138-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-25459
Species: Hu, Rt
Applications: WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-81807
Species: Hu
Applications: IHC,  IHC-P
NBP1-54805
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
5609-MU
Species: Hu
Applications: Bind
DY1857
Species: Mu
Applications: ELISA
NBP1-86214
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-77282
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP) (0)

There are no publications for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP) (0)

There are no reviews for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase VB/CA5B Products

Research Areas for Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP)

Find related products by research area.

Blogs on Carbonic Anhydrase VB/CA5B

There are no specific blogs for Carbonic Anhydrase VB/CA5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase VB/CA5B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CA5B