Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 5/CHST5 Antibody [NBP3-17221] - Staining of human rectum shows moderate membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free (NBP3-17221) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

• carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
• Carbohydrate Sulfotransferase 5
• CHST5
• GlcNAc6ST3
• gn6st-3
• GST4-alpha
• hIGn6ST
• I-GlcNAc6ST

Background

CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHST5