Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free (NBP3-17221) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHST5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free
Background
CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221) (0)
There are no publications for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221) (0)
There are no reviews for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carbohydrate Sulfotransferase 5/CHST5 Products
Research Areas for Carbohydrate Sulfotransferase 5/CHST5 Antibody (NBP3-17221)
Find related products by research area.
|
Blogs on Carbohydrate Sulfotransferase 5/CHST5