![Western Blot: CAPS2 Antibody (3C6) [H00084698-M02] - Analysis of CAPS2 expression in transfected 293T cell line by CAPS2 monoclonal antibody (M02), clone 3C6.Lane 1: CAPS2 transfected lysate (Predicted MW: 33.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CAPS2-Antibody-3C6-Western-Blot-H00084698-M02-img0002.jpg "Western Blot: CAPS2 Antibody (3C6) [H00084698-M02] - Analysis of CAPS2 expression in transfected 293T cell line by CAPS2 monoclonal antibody (M02), clone 3C6.Lane 1: CAPS2 transfected lysate (Predicted MW: 33.7 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3C6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse CAPS2 Antibody (3C6) - Azide and BSA Free (H00084698-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | CAPS2 (NP_115995.1, 285 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISGHSTEEEIKSSFLETLKVACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVNILRTPWGI |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CAPS2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CAPS2 Antibody (H00084698-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: CAPS2 Antibody (3C6) [H00084698-M02] - Detection limit for recombinant GST tagged CAPS2 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CAPS2-Antibody-3C6-Sandwich-ELISA-H00084698-M02-img0001.jpg "Sandwich ELISA: CAPS2 Antibody (3C6) [H00084698-M02] - Detection limit for recombinant GST tagged CAPS2 is 0.3 ng/ml as a capture antibody.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![NT-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NT-3 [Unconjugated]")
![Simple Western Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Simple_Western_21249.jpg)
![Western Blot Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Western_Blot_21254.jpg)
![Immunocytochemistry Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Immunocytochemistry__Immunofluorescence_17786.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
