CaM Kinase II gamma Antibody [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related CaM Kinase II gamma Primary Antibodies

Order Details


    • Catalog Number
      NBP3-37964AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CaM Kinase II gamma Antibody [Alexa Fluor® 405] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CaM Kinase II gamma (NP_751909.1).

Sequence:
LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMK2G
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for CaM Kinase II gamma Antibody [Alexa Fluor® 405]

  • calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma
  • calcium/calmodulin-dependent protein kinase II gamma
  • calcium/calmodulin-dependent protein kinase type II subunit gamma
  • CaM Kinase II gamma
  • CaM kinase II subunit gamma
  • CAMK
  • CAMK2G
  • CAMKG
  • CAMKGFLJ16043
  • CaMK-II subunit gamma
  • CAMK-II
  • EC 2.7.11
  • EC 2.7.11.17
  • MGC26678

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Six alternatively spliced variants that encode six different isoforms have been characterized to date. Additional alternative splice variants that encode different isoforms have been described, but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
QET00B
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for CaM Kinase II gamma Antibody (NBP3-37964AF405) (0)

There are no publications for CaM Kinase II gamma Antibody (NBP3-37964AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaM Kinase II gamma Antibody (NBP3-37964AF405) (0)

There are no reviews for CaM Kinase II gamma Antibody (NBP3-37964AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CaM Kinase II gamma Antibody (NBP3-37964AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CaM Kinase II gamma Products

Research Areas for CaM Kinase II gamma Antibody (NBP3-37964AF405)

Find related products by research area.

Blogs on CaM Kinase II gamma

There are no specific blogs for CaM Kinase II gamma, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CaM Kinase II gamma Antibody [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMK2G