Calsyntenin-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Calsyntenin-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Calsyntenin-1
  
  

  Source: E. coli

  Amino Acid Sequence: TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CLSTN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17025.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calsyntenin-1 Recombinant Protein Antigen

• alcadein alpha 1
• Alcadein-alpha
• ALC-ALPHA
• alcalpha1
• alcalpha2
• Alzheimer-related cadherin-like protein
• cadherin-related family member 12
• calsyntenin 1
• Calsyntenin1
• Calsyntenin-1
• CDHR12
• CLSTN1
• CS1
• CSTN1
• FLJ32258
• KIAA0911alcadein-alpha
• Non-classical cadherin XB31alpha
• non-classical cadherin XB31alpha1
• PIK3CD
• XB31alpha

Background

CLSTN1 (calsyntenin 1) is mainly expressed in brain tissues and to a lesser degree in heart, skeletal muscle and the placenta. It accumulates in dystrophic neurites around the amyloid core of Alzheimer disease senile plaques. The protein induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. It is involved in complex formation with APBA2 and APP, stabilizing APP metabolism and enhancing APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation. It may also modulate calcium-mediated postsynaptic signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CLSTN1