Recombinant Human Calcium Channel Flower Homolog GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Calcium Channel Flower Homolog GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-172 of Human CACFD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CACFD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calcium Channel Flower Homolog GST (N-Term) Protein

  • CACFD1
  • calcium channel flower homolog
  • chromosome 9 open reading frame 7
  • D9S2135
  • FLOWER

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI/CF
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6989
Species: Mu
Applications: IHC
210-TA
Species: Hu
Applications: BA

Publications for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01) (0)

There are no publications for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01) (0)

There are no reviews for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcium Channel Flower Homolog Products

Bioinformatics Tool for Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01)

Discover related pathways, diseases and genes to Calcium Channel Flower Homolog Recombinant Protein (H00011094-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Calcium Channel Flower Homolog

There are no specific blogs for Calcium Channel Flower Homolog, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calcium Channel Flower Homolog GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACFD1