CACNA1S Recombinant Protein Antigen

Images

 
There are currently no images for CACNA1S Protein (NBP2-33799PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CACNA1S Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1S.

Source: E. coli

Amino Acid Sequence: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1S
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33799.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CACNA1S Recombinant Protein Antigen

  • CACH1
  • CACN1
  • CACNA1S
  • CACNL1A3
  • CACNL1A3MHS5
  • calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle
  • Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle
  • calcium channel, voltage-dependent, L type, alpha 1S subunit
  • Cav1.1
  • CCHL1A3
  • dihydropyridine receptor
  • dihydropyridine-sensitive L-type calcium channel alpha-1 subunit
  • HOKPP
  • HOKPP1
  • hypokalemic periodic paralysis)
  • hypoPP
  • TTPP1
  • voltage-dependent L-type calcium channel subunit alpha-1S
  • Voltage-gated calcium channel subunit alpha Cav1.1

Background

Voltage-sensitive calcium channels mediate the entry of calcium into many types of excitable cells and thus play a key role in neurotransmitter release and excitation-contraction (E-C) coupling. The 1,4-dihydropyridines (DHPs) are synthetic organic compounds which can be used to identify the L-type calcium channels that are found in all types of vertebrate muscle, neuronal and neuroendocrine cells. The DHP receptor is part of the L-type calcium channel complex and is thought to be the voltage sensor in E-C coupling.The purified DHP receptor isolated from triads is composed of at least four subunits. The alpha-1 subunit contains the binding site for the DHPs and shows high sequence homology to the voltage gated sodium channel. The alpha-2 subunit is a large glycoprotein associated with the DHP receptor which was first described in skeletal muscle and is also found in high concentrations in other excitable tissues such as cardiac muscle and brain and in low concentrations in most other tissues studied. The other two subunits that co-purify with the DHP receptor are termed beta and gamma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP2-80143
Species: Am, Bv, Ca, Ch, Fi, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP2-30861
Species: Hu
Applications: ICC/IF
H00001806-M01
Species: Hu
Applications: DB, ELISA, ICC/IF, WB
NBP1-85224
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-33799PEP
Species: Hu
Applications: AC

Publications for CACNA1S Protein (NBP2-33799PEP) (0)

There are no publications for CACNA1S Protein (NBP2-33799PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1S Protein (NBP2-33799PEP) (0)

There are no reviews for CACNA1S Protein (NBP2-33799PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CACNA1S Protein (NBP2-33799PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA1S Products

Array NBP2-33799PEP

Research Areas for CACNA1S Protein (NBP2-33799PEP)

Find related products by research area.

Blogs on CACNA1S

There are no specific blogs for CACNA1S, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CACNA1S Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1S