CAAP1 Antibody

Immunocytochemistry/Immunofluorescence: CAAP1 Antibody [NBP1-94020] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CAAP1 Antibody [NBP1-94020] - Staining of human prostate shows moderate cytoplasmic/membranous positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: CAAP1 Antibody [NBP1-94020] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CAAP1 Antibody [NBP1-94020] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells and moderate cytoplasmic staining of endothelial cells.

Analysis in human cell line HeLa.

Product Discontinued

CAAP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LCQEQLELLSEKKILKILEGDNGMDSDMEEEADDGSKMGSDLVSQQDICIDSASSVRENKQPEGLELKQGKGEDSDVLSINADA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CAAP1 Antibody

• C9orf82
• CAAP
• caspase activity and apoptosis inhibitor 1
• chromosome 9 open reading frame 82
• FLJ13657
• RP11-337A23.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CAAP1 Antibody (NBP1-94020)(1)

Publication using NBP1-94020

• Wang X, Han Y, Hu G et al. Endoplasmic Reticulum Stress Induces miR-706, A Pro-Cell Death microRNA, in A Protein Kinase RNA-Like ER Kinase (PERK) and Activating Transcription Factor 4 (ATF4) Dependent Manner Cell J 2020-10-01 [PMID: 31863666] (WB)

Bioinformatics

• Gene Symbol: CAAP1