CA11 Antibody

Images

 
Western Blot: CA11 Antibody [H00000770-B02P] - Analysis of CA11 expression in transfected 293T cell line by CA11 polyclonal antibody. Lane 1: CA11 transfected lysate(36.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CA11 Antibody Summary

Immunogen
CA11 (NP_001208.2, 1 a.a. - 328 a.a.) full-length human protein. MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR
Specificity
Reacts with carbonic anhydrase XI.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CA11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CA11 Antibody

  • carbonic anhydrase XI
  • carbonic anhydrase-related protein 11
  • Carbonic anhydrase-related protein 2
  • carbonic anhydrase-related protein XI
  • CA-RP II
  • CA-RP XI
  • CARP-2
  • CARP2CARP XI
  • CARPX1
  • CA-XI

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XI is likely a secreted protein, however, radical changes at active site residues completely conserved in CA isozymes with catalytic activity, make it unlikely that it has carbonic anhydrase activity. It shares properties in common with two other acatalytic CA isoforms, CA VIII and CA X. CA XI is most abundantly expressed in brain, and may play a general role in the central nervous system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31586
Species: Hu
Applications: IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-56413
Species: Hu
Applications: WB, ICC/IF
NBP1-86626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000770-B02P
Species: Hu
Applications: WB

Publications for CA11 Antibody (H00000770-B02P) (0)

There are no publications for CA11 Antibody (H00000770-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CA11 Antibody (H00000770-B02P) (0)

There are no reviews for CA11 Antibody (H00000770-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CA11 Antibody (H00000770-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CA11 Products

Bioinformatics Tool for CA11 Antibody (H00000770-B02P)

Discover related pathways, diseases and genes to CA11 Antibody (H00000770-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CA11 Antibody (H00000770-B02P)

Discover more about diseases related to CA11 Antibody (H00000770-B02P).
 

Pathways for CA11 Antibody (H00000770-B02P)

View related products by pathway.

PTMs for CA11 Antibody (H00000770-B02P)

Learn more about PTMs related to CA11 Antibody (H00000770-B02P).
 

Research Areas for CA11 Antibody (H00000770-B02P)

Find related products by research area.

Blogs on CA11

There are no specific blogs for CA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CA11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA11
Entrez
Uniprot