BUD31 Antibody (1E10.)

Images

 
Sandwich ELISA: BUD31 Antibody (1E10) [H00008896-M10] - Detection limit for recombinant GST tagged G10 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BUD31 Antibody (1E10.) Summary

Immunogen
G10 (NP_003901, 35 a.a. - 144 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Specificity
G10 (1E10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BUD31
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BUD31 Antibody (1E10.)

  • BUD31 homolog (S. cerevisiae)
  • BUD31 homolog (yeast)
  • EDG-2
  • EDG2MGC111202
  • fSAP17
  • functional spliceosome-associated protein 17
  • G10 maternal transcript homolog
  • G10
  • maternal G10 transcript
  • protein BUD31 homolog
  • Protein EDG-2
  • Protein G10 homolog
  • YCR063W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NLS1014
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-03363
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF

Publications for BUD31 Antibody (H00008896-M10) (0)

There are no publications for BUD31 Antibody (H00008896-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BUD31 Antibody (H00008896-M10) (0)

There are no reviews for BUD31 Antibody (H00008896-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BUD31 Antibody (H00008896-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BUD31 Products

Bioinformatics Tool for BUD31 Antibody (H00008896-M10)

Discover related pathways, diseases and genes to BUD31 Antibody (H00008896-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BUD31 Antibody (H00008896-M10)

View related products by pathway.

Blogs on BUD31

There are no specific blogs for BUD31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BUD31 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol BUD31
Entrez
OMIM
Uniprot