BTG3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BTG3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTG3.
  
  

  Source: E. coli

  Amino Acid Sequence: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BTG3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89098.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BTG3 Recombinant Protein Antigen

• Abundant in neuroepithelium area protein
• ANATOB55
• B-cell translocation gene 3
• B-cell translocation gene10
• BTG family member 3
• BTG family, member 3
• MGC8928
• protein BTG3
• Protein Tob5
• tob55
• TOB5TOFA

Background

The protein encoded by the BTG3 gene is a member of the BTG/Tob family. This family has structurally related proteins thatappear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the centralnervous system. Two transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTG3