BTAF1 Recombinant Protein Antigen

Images

 
There are currently no images for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BTAF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTAF1.

Source: E.coli

Amino Acid Sequence: QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BTAF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57414 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BTAF1 Recombinant Protein Antigen

  • ATP-dependent helicase BTAF1
  • BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae)
  • B-TFIID transcription factor-associated 170 kDa subunit
  • EC 3.6.1
  • EC 3.6.4.-
  • MOT1MGC138406
  • TAF(II)170KIAA0940
  • TAF-172
  • TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae)
  • TAFII170TATA-binding protein-associated factor 172
  • TBP-associated factor 172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP2-47480
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-55408
Species: Hu
Applications: ICC/IF, WB
NBP2-16760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03839
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-81008
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57414PEP
Species: Hu
Applications: AC

Publications for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP) (0)

There are no publications for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP) (0)

There are no reviews for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BTAF1 Products

Array NBP2-57414PEP

Bioinformatics Tool for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP)

Discover related pathways, diseases and genes to BTAF1 Recombinant Protein Antigen (NBP2-57414PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP)

Discover more about diseases related to BTAF1 Recombinant Protein Antigen (NBP2-57414PEP).
 

Pathways for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP)

View related products by pathway.

PTMs for BTAF1 Recombinant Protein Antigen (NBP2-57414PEP)

Learn more about PTMs related to BTAF1 Recombinant Protein Antigen (NBP2-57414PEP).

Blogs on BTAF1

There are no specific blogs for BTAF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BTAF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BTAF1