beta-Arrestin 1 Antibody (F7C2)

Western Blot: beta-Arrestin 1 Antibody (F7C2) [NBP3-15335] - Western blot analysis of extracts of various cell lines, using beta-Arrestin 1 Rabbit mAb (NBP3-15335) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu
• Applications: WB
• Clone: F7C2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

beta-Arrestin 1 Antibody (F7C2) Summary

• Description: Novus Biologicals Rabbit beta-Arrestin 1 Antibody (F7C2) (NBP3-15335) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta-Arrestin 1 (P49407). MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ARRB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for beta-Arrestin 1 Antibody (F7C2)

• ARB1
• ARR1
• ARRB1
• arrestin 2
• Arrestin beta-1
• arrestin, beta 1
• betaArrestin 1
• beta-Arrestin 1
• beta-arrestin-1

Background

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization ofG-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones,neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in thebeta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the centralnervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin systemis believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcriptsencoding different isoforms of arrestin beta 1 have been described, however, their exact functions are not known.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARRB1