Recombinant Human Begain Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Begain Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-593 of Human BEGAIN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFCDGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BEGAIN
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Begain Protein

  • brain-enriched guanylate kinase-associated homolog (rat)
  • KIAA1446brain-enriched guanylate kinase-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-57704
Species: Hu
Applications: ICC/IF
NBP1-93467
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00057596-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Begain Recombinant Protein (H00057596-P01) (0)

There are no publications for Begain Recombinant Protein (H00057596-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Begain Recombinant Protein (H00057596-P01) (0)

There are no reviews for Begain Recombinant Protein (H00057596-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Begain Recombinant Protein (H00057596-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Begain Products

Bioinformatics Tool for Begain Recombinant Protein (H00057596-P01)

Discover related pathways, diseases and genes to Begain Recombinant Protein (H00057596-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Begain Recombinant Protein (H00057596-P01)

Discover more about diseases related to Begain Recombinant Protein (H00057596-P01).
 

Pathways for Begain Recombinant Protein (H00057596-P01)

View related products by pathway.

PTMs for Begain Recombinant Protein (H00057596-P01)

Learn more about PTMs related to Begain Recombinant Protein (H00057596-P01).

Blogs on Begain

There are no specific blogs for Begain, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Begain Antibody
NBP1-82907

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Begain Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BEGAIN