We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

BDP1 Recombinant Protein Antigen

Images

 
There are currently no images for BDP1 Recombinant Protein Antigen (NBP2-68607PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BDP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BDP1.

Source: E. coli

Amino Acid Sequence: EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPN18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68607.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BDP1 Recombinant Protein Antigen

  • BDP1
  • EC 3.1.3.48
  • protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
  • PTPN18
  • tyrosine-protein phosphatase non-receptor type 18

Background

BDP1 is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This gene was found to be expressed in brain, colon tissues, and several different tumor-derived cell lines. The bilogical function of this PTP has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-55335
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP (-), WB
2914-HT
Species: Hu
Applications: BA
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-83654
Species: Hu
Applications: IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-15617
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-74245
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00006621-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
1129-ER
Species: Hu
Applications: BA
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
4308-SE
Species: Hu
Applications: EnzAct

Publications for BDP1 Recombinant Protein Antigen (NBP2-68607PEP) (0)

There are no publications for BDP1 Recombinant Protein Antigen (NBP2-68607PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BDP1 Recombinant Protein Antigen (NBP2-68607PEP) (0)

There are no reviews for BDP1 Recombinant Protein Antigen (NBP2-68607PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BDP1 Recombinant Protein Antigen (NBP2-68607PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BDP1 Products

Research Areas for BDP1 Recombinant Protein Antigen (NBP2-68607PEP)

Find related products by research area.

Blogs on BDP1

There are no specific blogs for BDP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BDP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN18