BCL7B Antibody (4G1) - Azide and BSA Free

Western Blot: BCL7B Antibody (4G1) [H00009275-M02] - Analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M02), clone 4G1.Lane 1: BCL7B transfected lysate(22.2 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BCL7B Antibody (4G1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse BCL7B Antibody (4G1) - Azide and BSA Free (H00009275-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BCL7B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL7B Antibody (4G1) - Azide and BSA Free

• Allergen Hom s 3
• B-cell CLL/lymphoma 7 protein family member B
• B-cell CLL/lymphoma 7B

Background

The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL7B
• Uniprot:
  • NP_001698(Human)