BCAS2 Antibody [Janelia Fluor® 525]

Product Discontinued

BCAS2 Antibody [Janelia Fluor® 525] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human BCAS2 (NP_005863.1).
  
  Sequence:
  MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for BCAS2 Antibody [Janelia Fluor® 525]

• breast carcinoma amplified sequence 2
• Breast carcinoma-amplified sequence 2
• DAM1DNA amplified in mammary carcinoma 1 protein
• pre-mRNA-splicing factor SPF27
• Snt309
• SPF27
• spliceosome associated protein, amplified in breast cancer
• Spliceosome-associated protein SPF 27

Background

BCAS2 is a Ubiquitously expressed nuclear protein associated with the splicesome. The deduced 225-amino acid protein contains a central potential N-glycosylation site and multiple N-terminal potential phosphorylation sites. Northern and Southern blot analyses demonstrates expression of a 1.5-kb transcript at various levels in multiple breast cancer cell lines, with greatest amplification in BT-20 and MCF-7 cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAS2