BBS5 Recombinant Protein Antigen

Images

 
There are currently no images for BBS5 Recombinant Protein Antigen (NBP2-46722PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BBS5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BBS5.

Source: E.coli

Amino Acid Sequence: DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BBS5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-46722. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BBS5 Recombinant Protein Antigen

  • Bardet-Biedl syndrome 5 protein
  • Bardet-Biedl syndrome 5
  • DKFZp762I194

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69082
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79684
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55108
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003757-Q01
Species: Hu
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-87115
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-46722PEP
Species: Hu
Applications: AC

Publications for BBS5 Recombinant Protein Antigen (NBP2-46722PEP) (0)

There are no publications for BBS5 Recombinant Protein Antigen (NBP2-46722PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS5 Recombinant Protein Antigen (NBP2-46722PEP) (0)

There are no reviews for BBS5 Recombinant Protein Antigen (NBP2-46722PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BBS5 Recombinant Protein Antigen (NBP2-46722PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional BBS5 Products

Bioinformatics Tool for BBS5 Recombinant Protein Antigen (NBP2-46722PEP)

Discover related pathways, diseases and genes to BBS5 Recombinant Protein Antigen (NBP2-46722PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS5 Recombinant Protein Antigen (NBP2-46722PEP)

Discover more about diseases related to BBS5 Recombinant Protein Antigen (NBP2-46722PEP).
 

Pathways for BBS5 Recombinant Protein Antigen (NBP2-46722PEP)

View related products by pathway.

Research Areas for BBS5 Recombinant Protein Antigen (NBP2-46722PEP)

Find related products by research area.

Blogs on BBS5

There are no specific blogs for BBS5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PGK1 Antibody
NBP2-19784

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BBS5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS5