Recombinant Human BBS1 Protein

Images

 
SDS-Page: Recombinant Human BBS1 Protein [H00000582-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BBS1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-109 of Human BBS1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BBS1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BBS1 Protein

  • Bardet-Biedl syndrome 1 protein
  • Bardet-Biedl syndrome 1
  • BBS2L2
  • BBS2-like protein 2
  • FLJ23590
  • MGC126183
  • MGC126184
  • MGC51114

Background

BBS1 - Bardet-Biedl syndrome 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-15747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000582-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BBS1 Partial Recombinant Protein (H00000582-Q01) (0)

There are no publications for BBS1 Partial Recombinant Protein (H00000582-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS1 Partial Recombinant Protein (H00000582-Q01) (0)

There are no reviews for BBS1 Partial Recombinant Protein (H00000582-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BBS1 Partial Recombinant Protein (H00000582-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BBS1 Products

Bioinformatics Tool for BBS1 Partial Recombinant Protein (H00000582-Q01)

Discover related pathways, diseases and genes to BBS1 Partial Recombinant Protein (H00000582-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS1 Partial Recombinant Protein (H00000582-Q01)

Discover more about diseases related to BBS1 Partial Recombinant Protein (H00000582-Q01).
 

Pathways for BBS1 Partial Recombinant Protein (H00000582-Q01)

View related products by pathway.

PTMs for BBS1 Partial Recombinant Protein (H00000582-Q01)

Learn more about PTMs related to BBS1 Partial Recombinant Protein (H00000582-Q01).
 

Research Areas for BBS1 Partial Recombinant Protein (H00000582-Q01)

Find related products by research area.

Blogs on BBS1

There are no specific blogs for BBS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BBS1 Antibody
NBP2-34106
CEP290 Antibody
NB100-86991

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BBS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS1