BAZ2B Antibody

Images

 
Immunohistochemistry-Paraffin: BAZ2B Antibody [NBP1-80622] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAZ2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NAGANGCTLSYQNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFYSPLPNDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKS
Specificity
Specificity of human BAZ2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAZ2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For Immunohistochemistry-Paraffin: HIER pH6 retrieval is recommended.
Control Peptide
BAZ2B Protein (NBP1-80622PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAZ2B Antibody

  • bromodomain adjacent to zinc finger domain protein 2B
  • bromodomain adjacent to zinc finger domain, 2B
  • DKFZp434H071
  • DKFZp762I0516
  • FLJ45644
  • hWALp4
  • KIAA1476
  • WALp4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61041
Species: Hu
Applications: WB, IP
NBP2-59158
Species: Hu, Mu
Applications: WB, ChIP
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB600-279
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu

Publications for BAZ2B Antibody (NBP1-80622) (0)

There are no publications for BAZ2B Antibody (NBP1-80622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAZ2B Antibody (NBP1-80622) (0)

There are no reviews for BAZ2B Antibody (NBP1-80622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BAZ2B Antibody (NBP1-80622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BAZ2B Antibody (NBP1-80622)

Discover related pathways, diseases and genes to BAZ2B Antibody (NBP1-80622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAZ2B Antibody (NBP1-80622)

Discover more about diseases related to BAZ2B Antibody (NBP1-80622).
 

Pathways for BAZ2B Antibody (NBP1-80622)

View related products by pathway.

Blogs on BAZ2B

There are no specific blogs for BAZ2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAZ2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAZ2B
Entrez
Uniprot