B3GALT6 Antibody (3E5)

Images

 
Western Blot: B3GALT6 Antibody (3E5) [H00126792-M06] - Analysis of B3GALT6 expression in transfected 293T cell line by B3GALT6 monoclonal antibody (M06), clone 3E5. Lane 1: B3GALT6 transfected lysate (Predicted MW: ...read more
Sandwich ELISA: B3GALT6 Antibody (3E5) [H00126792-M06] - Detection limit for recombinant GST tagged B3GALT6 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

B3GALT6 Antibody (3E5) Summary

Immunogen
B3GALT6 (NP_542172, 229 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
Specificity
B3GALT6 (3E5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
B3GALT6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00126792-M06.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B3GALT6 Antibody (3E5)

  • beta-1,3-galactosyltransferase 6
  • Beta-1,3-GalTase 6
  • beta3GalT6
  • beta3Gal-T6
  • EC 2.4.1.134
  • Galactosyltransferase II
  • Galactosylxylosylprotein 3-beta-galactosyltransferase
  • UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88652
Species: ChHa, Hu
Applications: IHC, IHC-P, WB
NBP1-69327
Species: Hu
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00010317-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-88662
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84581
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-35006
Species: Hu
Applications: Func, PAGE
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
H00126792-M06
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for B3GALT6 Antibody (H00126792-M06)(1)

Reviews for B3GALT6 Antibody (H00126792-M06) (0)

There are no reviews for B3GALT6 Antibody (H00126792-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALT6 Antibody (H00126792-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALT6 Products

Array H00126792-M06

Bioinformatics Tool for B3GALT6 Antibody (H00126792-M06)

Discover related pathways, diseases and genes to B3GALT6 Antibody (H00126792-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B3GALT6

There are no specific blogs for B3GALT6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALT6 Antibody (3E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT6
Entrez
Uniprot