Recombinant Human Axotrophin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Axotrophin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 66-136 of Human MARCH7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG

Protein/Peptide Type
Partial Recombinant Protein
Gene
MARCH7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Axotrophin Protein

  • AXO
  • AXOT
  • Axotrophin
  • E3 ubiquitin-protein ligase MARCH7
  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH-VIIDKFZp586F1122
  • membrane-associated ring finger (C3HC4) 7
  • Membrane-associated RING finger protein 7
  • Membrane-associated RING-CH protein VII
  • RING finger protein 177
  • RNF177axotrophin

Background

MARCH7 - membrane-associated ring finger (C3HC4) 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-13780
Species: Hu
Applications: IHC, IHC-P

Publications for Axotrophin Partial Recombinant Protein (H00064844-Q01) (0)

There are no publications for Axotrophin Partial Recombinant Protein (H00064844-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axotrophin Partial Recombinant Protein (H00064844-Q01) (0)

There are no reviews for Axotrophin Partial Recombinant Protein (H00064844-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Axotrophin Partial Recombinant Protein (H00064844-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Axotrophin Products

Bioinformatics Tool for Axotrophin Partial Recombinant Protein (H00064844-Q01)

Discover related pathways, diseases and genes to Axotrophin Partial Recombinant Protein (H00064844-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axotrophin Partial Recombinant Protein (H00064844-Q01)

Discover more about diseases related to Axotrophin Partial Recombinant Protein (H00064844-Q01).
 

Pathways for Axotrophin Partial Recombinant Protein (H00064844-Q01)

View related products by pathway.

Research Areas for Axotrophin Partial Recombinant Protein (H00064844-Q01)

Find related products by research area.

Blogs on Axotrophin

There are no specific blogs for Axotrophin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Axotrophin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH7