Recombinant Human ATP6V1E1 Protein

Images

 
SDS-Page: Recombinant Human ATP6V1E1 Protein [H00000529-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATP6V1E1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-91 of Human ATP6V1E1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP6V1E1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP6V1E1 Protein

  • ATP6E2ATP6V1E
  • ATP6E31kDa subunit
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD
  • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1
  • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
  • H+-transporting ATP synthase chain E, vacuolar
  • p31
  • Vacuolar proton pump subunit E 1
  • V-ATPase 31 kDa subunit
  • V-ATPase subunit E 1
  • V-ATPase, subunit E
  • Vma4
  • V-type proton ATPase subunit E 1

Background

ATP6V1E1 - ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4185
Species: Hu
Applications: ICC
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7250
Species: Hu
Applications: IHC
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF

Publications for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01) (0)

There are no publications for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01) (0)

There are no reviews for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1E1 Products

Bioinformatics Tool for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01)

Discover related pathways, diseases and genes to ATP6V1E1 Partial Recombinant Protein (H00000529-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01)

Discover more about diseases related to ATP6V1E1 Partial Recombinant Protein (H00000529-Q01).
 

Pathways for ATP6V1E1 Partial Recombinant Protein (H00000529-Q01)

View related products by pathway.

Blogs on ATP6V1E1

There are no specific blogs for ATP6V1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP6V1E1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1E1