ATP5E Antibody (2F3)


Western Blot: ATP5E Antibody (2F3) [H00000514-M01] - ATP5E monoclonal antibody (M01), clone 2F3 Analysis of ATP5E expression in SW-13.
Immunohistochemistry-Paraffin: ATP5E Antibody (2F3) [H00000514-M01] - Analysis of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P

Order Details

ATP5E Antibody (2F3) Summary

ATP5E (AAH01690, 1 a.a. - 51 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
ATP5E - ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Read Publications using H00000514-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5E Antibody (2F3)

  • ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
  • ATPE
  • F(0)F(1)-ATPase
  • H(+)-transporting two-sector ATPase
  • MGC104243
  • mitochondrial ATP synthase epsilon chain
  • mitochondrial ATPase
  • mitochondrial


This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Applications: WB, IHC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5E Antibody (H00000514-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATP5E Products

Bioinformatics Tool for ATP5E Antibody (H00000514-M01)

Discover related pathways, diseases and genes to ATP5E Antibody (H00000514-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5E Antibody (H00000514-M01)

Discover more about diseases related to ATP5E Antibody (H00000514-M01).

Pathways for ATP5E Antibody (H00000514-M01)

View related products by pathway.

PTMs for ATP5E Antibody (H00000514-M01)

Learn more about PTMs related to ATP5E Antibody (H00000514-M01).

Blogs on ATP5E

There are no specific blogs for ATP5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP5E Antibody (2F3) and receive a gift card or discount.


Gene Symbol ATP5E