ATP5E Antibody (2F3)

Product Discontinued

ATP5E Antibody (2F3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP5E (AAH01690, 1 a.a. - 51 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
• Specificity: ATP5E - ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP5E
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5E Antibody (2F3)

• ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
• ATPE
• F(0)F(1)-ATPase
• H(+)-transporting two-sector ATPase
• MGC104243
• mitochondrial ATP synthase epsilon chain
• mitochondrial ATPase
• mitochondrial

Background

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP5E Antibody (H00000514-M01)(5)

Publications using H00000514-M01

• Pecina P, Nuskova H, Karbanova V et al. Role of the mitochondrial ATP synthase central stalk subunits gamma and delta in the activity and assembly of the mammalian enzyme. Biochim Biophys Acta Bioenerg 2018-05-01 [PMID: 29499186] (Human)
• Fujikawa M, Sugawara K, Tanabe T, Yoshida M. Assembly of human mitochondrial ATP synthase through two separate intermediates, F 1-c-ring and beg complex. FEBS Lett. 2015-08-20 [PMID: 26297831]
• Fujikawa M, Imamura H, Nakamura J, Yoshida M. Assessing actual contribution of IF1, inhibitor of mitochondrial FoF1, to ATP homeostasis, cell growth, mitochondrial morphology, and cell viability. J Biol Chem. 2012-05-25 [PMID: 22493494]
• Mayr JA, Havlickova V, Zimmermann F et al. Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 {varepsilon} subunit. Hum Mol Genet. 2010-07-01 [PMID: 20566710]
• Havlickova V, Kaplanova V, Nuskova H et al. Knockdown of F(1) epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c. Biochim Biophys Acta. 2009-12-21 [PMID: 20026007]

Bioinformatics

• Gene Symbol: ATP5E
• Entrez:
  • 514(Human)
• OMIM:
  • 606153(Human)
• Uniprot:
  • AAH01690(Human)