ATP5E Antibody (1A8)

Images

 
Sandwich ELISA: ATP5E Antibody (1A8) [H00000514-M02] - Detection limit for recombinant GST tagged ATP5E is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP5E Antibody (1A8) Summary

Immunogen
ATP5E (AAH01690, 1 a.a. - 51 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP5E
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5E Antibody (1A8)

  • ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
  • ATPE
  • F(0)F(1)-ATPase
  • H(+)-transporting two-sector ATPase
  • MGC104243
  • mitochondrial ATP synthase epsilon chain
  • mitochondrial ATPase
  • mitochondrial

Background

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02249
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-46555
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
NBP1-59168
Species: Hu
Applications: WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF

Publications for ATP5E Antibody (H00000514-M02) (0)

There are no publications for ATP5E Antibody (H00000514-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5E Antibody (H00000514-M02) (0)

There are no reviews for ATP5E Antibody (H00000514-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5E Antibody (H00000514-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5E Products

Bioinformatics Tool for ATP5E Antibody (H00000514-M02)

Discover related pathways, diseases and genes to ATP5E Antibody (H00000514-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5E Antibody (H00000514-M02)

Discover more about diseases related to ATP5E Antibody (H00000514-M02).
 

Pathways for ATP5E Antibody (H00000514-M02)

View related products by pathway.

PTMs for ATP5E Antibody (H00000514-M02)

Learn more about PTMs related to ATP5E Antibody (H00000514-M02).

Blogs on ATP5E

There are no specific blogs for ATP5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5E Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5E
Uniprot