ATP13A4 Antibody

Images

 
Immunohistochemistry-Paraffin: ATP13A4 Antibody [NBP2-14328] Staining of human heart muscle shows distinct cytoplasmic positivity in myocytes.

Product Details

Summary
Product Discontinued
View other related ATP13A4 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14328
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATP13A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFPFSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP13A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP13A4 Antibody

  • probable cation-transporting ATPase 13A4
  • ATPase type 13A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-30503
Species: Hu
Applications: IHC, IHC-P
NBP2-30651
Species: Hu
Applications: IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-90867
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97719
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-57086
Species: Hu
Applications: WB, ICC/IF
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5184
Species: Hu
Applications: WB
H00140803-R03
Species: Hu
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14328
Species: Hu
Applications: IHC, IHC-P

Publications for ATP13A4 Antibody (NBP2-14328) (0)

There are no publications for ATP13A4 Antibody (NBP2-14328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP13A4 Antibody (NBP2-14328) (0)

There are no reviews for ATP13A4 Antibody (NBP2-14328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP13A4 Antibody (NBP2-14328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP13A4 Products

ATP13A4 NBP2-14328

Bioinformatics Tool for ATP13A4 Antibody (NBP2-14328)

Discover related pathways, diseases and genes to ATP13A4 Antibody (NBP2-14328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP13A4 Antibody (NBP2-14328)

Discover more about diseases related to ATP13A4 Antibody (NBP2-14328).
 

Pathways for ATP13A4 Antibody (NBP2-14328)

View related products by pathway.

Blogs on ATP13A4

There are no specific blogs for ATP13A4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP13A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP13A4