ATP13A4 Antibody

Product Discontinued

ATP13A4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFPFSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP13A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP13A4 Antibody

• probable cation-transporting ATPase 13A4
• ATPase type 13A4

Background

ATP13A4 is a gene that codes for a protein with four isoforms with lengths of 1196, 840, 576, and 212 amino acids and weights of approximately 134, 94, 65, and 24 kDa respectively. Current studies are being done on diseases and disorders linked to this gene including nephrocalcinosis, Parkinson's disease, malaria, neuronitis, and benign epilepsy with centrotemporal spikes. ATP13A4 has also been shown to have interactions with HES4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP13A4