ATP13A1 Antibody

Images

 
Immunohistochemistry: ATP13A1 Antibody [NBP2-30717] - Staining of squamous epithelium shows distinct positivity in Langerhans cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP13A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DKTGTLTSDSLVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKDEKVFPRSIKTQGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP13A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP13A1 Protein (NBP2-30717PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP13A1 Antibody

  • ATP13A
  • ATPase type 13A
  • ATPase type 13A1
  • cation transporting ATPase
  • CGI-152
  • DKFZp761L1623
  • EC 3.6.3
  • EC 3.6.3.-
  • EC 3.6.3.12
  • FLJ31858
  • FLJ41786
  • FLJ43873
  • KIAA1825FLJ90317
  • probable cation-transporting ATPase 13A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-06049
Species: Hu
NBP2-30503
Species: Hu
Applications: IHC, IHC-P
NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-90867
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-06757
Species: Hu
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00027032-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30717
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ATP13A1 Antibody (NBP2-30717) (0)

There are no publications for ATP13A1 Antibody (NBP2-30717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP13A1 Antibody (NBP2-30717) (0)

There are no reviews for ATP13A1 Antibody (NBP2-30717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP13A1 Antibody (NBP2-30717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP13A1 Products

Bioinformatics Tool for ATP13A1 Antibody (NBP2-30717)

Discover related pathways, diseases and genes to ATP13A1 Antibody (NBP2-30717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP13A1 Antibody (NBP2-30717)

Discover more about diseases related to ATP13A1 Antibody (NBP2-30717).
 

Pathways for ATP13A1 Antibody (NBP2-30717)

View related products by pathway.

Blogs on ATP13A1

There are no specific blogs for ATP13A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP13A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP13A1
Uniprot