ATG2A Antibody

Images

 
Immunohistochemistry-Paraffin: ATG2A Antibody [NBP1-83009] - Staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells and red blood cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATG2A Protein (NBP1-83009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG2A Antibody

  • ATG2 autophagy related 2 homolog A (S. cerevisiae)
  • autophagy-related protein 2 homolog A
  • KIAA0404MGC117153

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF853
Species: Mu
Applications: WB, IHC
NBP1-52926
Species: Hu
Applications: WB
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33488
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4324
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NBP1-83009
Species: Hu
Applications: IHC, IHC-P

Publications for ATG2A Antibody (NBP1-83009) (0)

There are no publications for ATG2A Antibody (NBP1-83009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG2A Antibody (NBP1-83009) (0)

There are no reviews for ATG2A Antibody (NBP1-83009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATG2A Antibody (NBP1-83009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG2A Products

Bioinformatics Tool for ATG2A Antibody (NBP1-83009)

Discover related pathways, diseases and genes to ATG2A Antibody (NBP1-83009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG2A Antibody (NBP1-83009)

Discover more about diseases related to ATG2A Antibody (NBP1-83009).
 

Pathways for ATG2A Antibody (NBP1-83009)

View related products by pathway.

Blogs on ATG2A

There are no specific blogs for ATG2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG2A