Aspartate beta hydroxylase Antibody

Images

 
Western Blot: Aspartate beta hydroxylase Antibody [H00000444-B02P] - Analysis of ASPH expression in transfected 293T cell line by ASPH polyclonal antibody. Lane 1: ASPH transfected lysate(23.1 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse

Order Details

Aspartate beta hydroxylase Antibody Summary

Immunogen
ASPH (NP_115856.1, 1 a.a. - 210 a.a.) full-length human protein. MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Specificity
ASPH - aspartate beta-hydroxylase,
Clonality
Polyclonal
Host
Mouse
Gene
ASPH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aspartate beta hydroxylase Antibody

  • AAH
  • ASP beta-hydroxylase
  • aspartate beta-hydroxylaseA beta H-J-J
  • aspartyl/asparaginyl-beta-hydroxylase
  • BAH
  • cardiac junctin
  • CASQ2BP1
  • EC 1.14.11.16
  • HAAHaspartyl/asparaginyl beta-hydroxylase
  • humbug
  • JCTN
  • junctate
  • junctin
  • Peptide-aspartate beta-dioxygenase

Background

This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5745R
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-90091
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-582
Species: Hu, Mu, Rt, Po, Ca, Ch, GP, Rb, Sh
Applications: WB, IHC-P, IP, ICC, IF
NBP1-87304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74240
Species: Rt
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Aspartate beta hydroxylase Antibody (H00000444-B02P) (0)

There are no publications for Aspartate beta hydroxylase Antibody (H00000444-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartate beta hydroxylase Antibody (H00000444-B02P) (0)

There are no reviews for Aspartate beta hydroxylase Antibody (H00000444-B02P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartate beta hydroxylase Antibody (H00000444-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aspartate beta hydroxylase Antibody Products

Related Products by Gene

Bioinformatics Tool for Aspartate beta hydroxylase Antibody (H00000444-B02P)

Discover related pathways, diseases and genes to Aspartate beta hydroxylase Antibody (H00000444-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartate beta hydroxylase Antibody (H00000444-B02P)

Discover more about diseases related to Aspartate beta hydroxylase Antibody (H00000444-B02P).
 

Pathways for Aspartate beta hydroxylase Antibody (H00000444-B02P)

View related products by pathway.

PTMs for Aspartate beta hydroxylase Antibody (H00000444-B02P)

Learn more about PTMs related to Aspartate beta hydroxylase Antibody (H00000444-B02P).
 

Research Areas for Aspartate beta hydroxylase Antibody (H00000444-B02P)

Find related products by research area.

Blogs on Aspartate beta hydroxylase

There are no specific blogs for Aspartate beta hydroxylase, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Aspartate beta hydroxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPH
Entrez
Uniprot

Customers Who Bought This Also Bought