ASB6 Antibody - BSA Free

Western Blot: ASB6 Antibody [NBP3-10807] - Western blot analysis of ASB6 in Human U937 Whole Cell lysates. Antibody dilution at 1ug/ml

Product Discontinued

ASB6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ASB6 Antibody - BSA Free (NBP3-10807) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASB6 (NP_001189332.1). Peptide sequence SLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNAL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ASB6 Antibody - BSA Free

• ankyrin repeat and SOCS box containing 6
• ankyrin repeat and SOCS box protein 6
• ankyrin repeat and SOCS box-containing 6
• ASB-6
• FLJ20548
• MGC1024

Background

ASB6 is encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASB6