ASB11 Antibody - BSA Free

Western Blot: ASB11 Antibody [NBP2-84471] - WB Suggested Anti-Asb11 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Muscle

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ASB11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ASB11 Antibody - BSA Free (NBP2-84471) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of ASB11. Peptide sequence: FGDYICHTFQGDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLVTINRV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ASB11 Antibody - BSA Free

• ankyrin repeat and SOCS box containing 11
• ankyrin repeat and SOCS box protein 11
• ankyrin repeat and SOCS box-containing 11
• ankyrin repeat domain-containing SOCS box protein ASB11
• ASB-11
• DKFZp779E2460
• MGC119168
• MGC119169

Background

The ankyrin repeat and SOCS box-containing (Asb) protein family is comprised of members which each contain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASB11