ART3 Antibody (1D2)

Images

 
Western Blot: ART3 Antibody (1D2) [H00000419-M09] - Analysis of ART3 expression in transfected 293T cell line by ART3 monoclonal antibody (M09), clone 1D2. Lane 1: ART3 transfected lysatE (42.7 KDa). Lane 2: ...read more
Immunoprecipitation: ART3 Antibody (1D2) [H00000419-M09] - Analysis of ART3 transfected lysate using anti-ART3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ART3 rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ART3 Antibody (1D2) Summary

Immunogen
ART3 (NP_001170, 29 a.a. - 138 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ART3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ART3 Antibody (1D2)

  • ADP-ribosyltransferase 3
  • EC 2.4.2.31
  • ecto-ADP-ribosyltransferase 3
  • FLJ26404
  • Mono(ADP-ribosyl)transferase 3
  • mono-ADP-ribosyltransferase
  • NAD(P)(+)--arginine ADP-ribosyltransferase 3
  • TMART

Background

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases, such as ART3, transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases (see PARG; MIM 603501) reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-65853
Species: Mu
Applications: Flow, IP
H00000420-B01P
Species: Hu
Applications: WB
NBP2-13663
Species: Hu
Applications: IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB400-129
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3518
Species: Mu
Applications: Flow, CyTOF-ready

Publications for ART3 Antibody (H00000419-M09) (0)

There are no publications for ART3 Antibody (H00000419-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ART3 Antibody (H00000419-M09) (0)

There are no reviews for ART3 Antibody (H00000419-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ART3 Antibody (H00000419-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ART3 Products

Bioinformatics Tool for ART3 Antibody (H00000419-M09)

Discover related pathways, diseases and genes to ART3 Antibody (H00000419-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ART3 Antibody (H00000419-M09)

Discover more about diseases related to ART3 Antibody (H00000419-M09).
 

Pathways for ART3 Antibody (H00000419-M09)

View related products by pathway.

PTMs for ART3 Antibody (H00000419-M09)

Learn more about PTMs related to ART3 Antibody (H00000419-M09).

Blogs on ART3

There are no specific blogs for ART3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ART3 Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ART3
Uniprot